Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003387 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003387, RRID:AB_1846356
- Product name
- Anti-CDK1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEI
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWK
PGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM
ALNHPYFNDLDNQIKKM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells.
Sousa MM, Zub KA, Aas PA, Hanssen-Bauer A, Demirovic A, Sarno A, Tian E, Liabakk NB, Slupphaug G
PloS one 2013;8(2):e55493
PloS one 2013;8(2):e55493
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA003387 antibody. Corresponding CDK1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN